Request QuoteCatalog Number: xP518996HWWSize: 0.2-1mg

Request Quote

Recombinant Envelope glycoprotein N (UL73)

Recombinant Envelope glycoprotein N (UL73) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP518996HWWYeast1mgQuote
EP518996HWWE. coli1mgQuote
BP518996HWWBaculovirus200ugQuote
MP518996HWWMammalian Cell200ugQuote

Protein Information

SpeciesHuman cytomegalovirus (strain Merlin) (HHV-5) (Human herpesvirus 5)
UniProt IDF5HHQ0
Gene NameUL73
Protein NameEnvelope glycoprotein N
Region Expressed20-135
Expression Tag6xHis
Purity>90%
AA SequenceNNTSTASTPRPSSSTHASTTVKATTVATTSTTTATSTSSTTSAKPGSTTHDPNVMRPHAH NDFYNAHCTSHMYELSLSSFAAWWTMLNALILMGAFCIVLRHCCFQNFTATTTKGY
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review