Request QuoteCatalog Number: xP007441LQPSize: 0.2-1mg

Request Quote

Recombinant EF-hand calcium-binding domain-containing protein 2

Recombinant EF-hand calcium-binding domain-containing protein 2 can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP007441LQPYeast1mgQuote
EP007441LQPE. coli1mgQuote
BP007441LQPBaculovirus200ugQuote
MP007441LQPMammalian Cell200ugQuote

Protein Information

SpeciesLottia gigantea (Owl limpet)
UniProt IDB3A0R9
Gene Name
Protein NameEF-hand calcium-binding domain-containing protein 2
Region Expressed23-119
Expression Tag6xHis
Purity>90%
AA SequenceWRIRIRRGRKIFRKIRPYIPFVIGAVGKRQAGDAEFQAKYNAAAEDGVFTDEEIKSVFGV DDNGFVEFKATYDVDGDGVVQVEEYETVVELTENLAG
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review