Request QuoteCatalog Number: xP515297SXVSize: 0.2-1mg

Request Quote

Recombinant Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit ost5 (ost5)

Recombinant Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit ost5 (ost5) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP515297SXVYeast1mgQuote
EP515297SXVE. coli1mgQuote
BP515297SXVBaculovirus200ugQuote
MP515297SXVMammalian Cell200ugQuote

Protein Information

SpeciesSchizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
UniProt IDG2TRU0
Gene Nameost5; ORFs:SPCC18.19c
Protein NameDolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit ost5
Region Expressed1-94
Expression Tag6xHis
Purity>90%
AA SequenceMSLNELIVAALKLFFYNKEQKSDCIFFCQVQIVIQISSSMFSLVIRRIHIRKLWYITVFT INASMFSGFFNNPSLLTPNENLLFQVGLHYSFAV
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review