Request QuoteCatalog Number: xP522509MOSize: 0.2-1mg

Request Quote

Recombinant DNA-directed RNA polymerase II subunit RPB11 (Polr2j)

Recombinant DNA-directed RNA polymerase II subunit RPB11 (Polr2j) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP522509MOYeast1mgQuote
EP522509MOE. coli1mgQuote
BP522509MOBaculovirus200ugQuote
MP522509MOMammalian Cell200ugQuote

Protein Information

SpeciesMus musculus (Mouse)
UniProt IDO08740
Gene NamePolr2j; aka: Rpo2-4
Protein NameDNA-directed RNA polymerase II subunit RPB11
Region Expressed1-117
Expression Tag6xHis
Purity>90%
AA SequenceMNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAG YKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRGAIKDKQEGIE
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review