Request QuoteCatalog Number: xP006487OFFSize: 0.2-1mg

Request Quote

Recombinant Defender against cell death 1 (DAD1)

Recombinant Defender against cell death 1 (DAD1) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP006487OFFYeast1mgQuote
EP006487OFFE. coli1mgQuote
BP006487OFFBaculovirus200ugQuote
MP006487OFFMammalian Cell200ugQuote

Protein Information

SpeciesOryza sativa subsp. indica (Rice)
UniProt IDA2XSY1
Gene NameDAD1; aka: DAD-1; ORFs:OsI_015174
Protein NameDefender against cell death 1
Region Expressed1-114
Expression Tag6xHis
Purity>90%
AA SequenceMPRATSDAKLLIQSLGKAYAATPTNLKIIDLYVVFAVATALIQVVYMGIVGSFPFNSFLS GVLSCIGTAVLAVCLRIQVNKDNKEFKDLPPERAFADFVLCNLVLHLVIMNFLG
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review