Request QuoteCatalog Number: xP006502BOSize: 0.2-1mg

Request Quote

Recombinant Death-associated protein-like 1 (DAPL1)

Recombinant Death-associated protein-like 1 (DAPL1) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP006502BOYeast1mgQuote
EP006502BOE. coli1mgQuote
BP006502BOBaculovirus200ugQuote
MP006502BOMammalian Cell200ugQuote

Protein Information

SpeciesBos taurus (Bovine)
UniProt IDA2VEA7
Gene NameDAPL1; aka: EEDA
Protein NameDeath-associated protein-like 1
Region Expressed1-107
Expression Tag6xHis
Purity>90%
AA SequenceMANEVQVQLSPLKGGHPPAVKAGGKRISKKQEIGILERHTKKTGLEKTSATANVAKIQTM DALNDTLEKLSHKFPAVAHMAHQKPRPALEKVTPLKRIYIIQQPRKC
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review