Request QuoteCatalog Number: xP526152TOYSize: 0.2-1mg

Request Quote

Recombinant Cytochrome c oxidase subunit 4 isoform 1, mitochondrial (COX4I1)

Recombinant Cytochrome c oxidase subunit 4 isoform 1, mitochondrial (COX4I1) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP526152TOYYeast1mgQuote
EP526152TOYE. coli1mgQuote
BP526152TOYBaculovirus200ugQuote
MP526152TOYMammalian Cell200ugQuote

Protein Information

SpeciesTrachypithecus cristatus (Silvered leaf-monkey) (Presbytis cristata)
UniProt IDO46588
Gene NameCOX4I1; aka: COX4
Protein NameCytochrome c oxidase subunit 4 isoform 1, mitochondrial
Region Expressed1-99
Expression Tag6xHis
Purity>90%
AA SequenceSVVKREDFSLPAYVDRRDYPLPDVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIK FKETFAEMNRGSNEWKTVVGTATFFIGFTALIIMWQKRY
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review