Request QuoteCatalog Number: xP527378DNHSize: 0.2-1mg

Request Quote

Recombinant Cytochrome c oxidase subunit 4 isoform 1, mitochondrial (COX4I1)

Recombinant Cytochrome c oxidase subunit 4 isoform 1, mitochondrial (COX4I1) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP527378DNHYeast1mgQuote
EP527378DNHE. coli1mgQuote
BP527378DNHBaculovirus200ugQuote
MP527378DNHMammalian Cell200ugQuote

Protein Information

SpeciesAotus azarae (Southern owl monkey) (Aotus azarai)
UniProt IDO46584
Gene NameCOX4I1; aka: COX4
Protein NameCytochrome c oxidase subunit 4 isoform 1, mitochondrial
Region Expressed1-144
Expression Tag6xHis
Purity>90%
AA SequenceSVVKSEDYALPSYVDRRDYPLPDVAHVRHLSASQKALKEKEKASWSSLSMDEKVELYRIQ FKESFAEMNRGSNEWKTVVGAAMFFIGFTAILIILEKRYVYGPLPHTFDKEWVAMQTKRM LDLKVNPVDGLASKWDYDKKEWKK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review