Request QuoteCatalog Number: xP525030SWDSize: 0.2-1mg

Request Quote

Recombinant Cytochrome c oxidase subunit 4 isoform 1, mitochondrial (COX4I1)

Recombinant Cytochrome c oxidase subunit 4 isoform 1, mitochondrial (COX4I1) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP525030SWDYeast1mgQuote
EP525030SWDE. coli1mgQuote
BP525030SWDBaculovirus200ugQuote
MP525030SWDMammalian Cell200ugQuote

Protein Information

SpeciesSaimiri sciureus (Common squirrel monkey)
UniProt IDO46582
Gene NameCOX4I1; aka: COX4
Protein NameCytochrome c oxidase subunit 4 isoform 1, mitochondrial
Region Expressed1-124
Expression Tag6xHis
Purity>90%
AA SequenceSVVKSEDYARPSYVDRRDYPLPDVAHVRHLSASQKALKEKEKASWSSLSMDEKVEKTVVG AAMFFIGFTAILVILEKRYVYGPLPHTFDKEWVAMQTKRMLDLKMNPIDGLASKWDYEKK EWKK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review