Request QuoteCatalog Number: xP006328HUSize: 0.2-1mg

Request Quote

Recombinant Cytochrome c (CYCS)

Recombinant Cytochrome c (CYCS) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP006328HUYeast1mgQuote
EP006328HUE. coli1mgRPA594Hu01; EP006328HU
BP006328HUBaculovirus200ugQuote
MP006328HUMammalian Cell200ugQuote

Protein Information

SpeciesHomo sapiens (Human)
UniProt IDP99999
Gene NameCYCS; aka: CYC
Protein NameCytochrome c
Region Expressed2-105
Expression Tag6xHis
Purity>90%
AA SequenceGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWG EDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review