Request QuoteCatalog Number: xP006328OFFSize: 0.2-1mg

Request Quote

Recombinant Cytochrome c (CC-1)

Recombinant Cytochrome c (CC-1) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP006328OFFYeast1mgQuote
EP006328OFFE. coli1mgQuote
BP006328OFFBaculovirus200ugQuote
MP006328OFFMammalian Cell200ugQuote

Protein Information

SpeciesOryza sativa subsp. indica (Rice)
UniProt IDA2Y4S9
Gene NameCC-1; ORFs:OsI_019322
Protein NameCytochrome c
Region Expressed2-112
Expression Tag6xHis
Purity>90%
AA SequenceASFSEAPPGNPKAGEKIFKTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTPGYSYSTAN KNMAVIWEENTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLISYLKEATS
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review