Request QuoteCatalog Number: xP005973RASize: 0.2-1mg

Request Quote

Recombinant Cysteine-rich PDZ-binding protein (Cript)

Recombinant Cysteine-rich PDZ-binding protein (Cript) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP005973RAYeast1mgQuote
EP005973RAE. coli1mgQuote
BP005973RABaculovirus200ugQuote
MP005973RAMammalian Cell200ugQuote

Protein Information

SpeciesRattus norvegicus (Rat)
UniProt IDQ792Q4
Gene NameCript
Protein NameCysteine-rich PDZ-binding protein
Region Expressed1-101
Expression Tag6xHis
Purity>90%
AA SequenceMVCEKCEKKLGRVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRI CKSSVHQPGSHYCQGCAYKKGICAMCGKKVLDTKNYKQTSV
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review