Request QuoteCatalog Number: xP525960VEWSize: 0.2-1mg

Request Quote

Recombinant Cryptic phage CTXphi transcriptional repressor rstR (rstR)

Recombinant Cryptic phage CTXphi transcriptional repressor rstR (rstR) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP525960VEWYeast1mgQuote
EP525960VEWE. coli1mgQuote
BP525960VEWBaculovirus200ugQuote
MP525960VEWMammalian Cell200ugQuote

Protein Information

SpeciesVibrio cholerae
UniProt IDO85264
Gene NamerstR
Protein NameCryptic phage CTXphi transcriptional repressor rstR
Region Expressed1-111
Expression Tag6xHis
Purity>90%
AA SequenceMFSSKIRDLRVERDLNQEEVANGIGVGKNTYLAYEKGTQSPKLETVEKLAKFYGVPIAEL VSDSETNIDEKLKSKIRMIESLDEPEKESLFILMEALLMRSKSREIQKEFR
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review