Request QuoteCatalog Number: xP303258MVZSize: 0.2-1mg

Request Quote

Recombinant Copper-sensing transcriptional repressor CsoR (csoR)

Recombinant Copper-sensing transcriptional repressor CsoR (csoR) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP303258MVZYeast1mgQuote
EP303258MVZE. coli1mgQuote
BP303258MVZBaculovirus200ugQuote
MP303258MVZMammalian Cell200ugQuote

Protein Information

SpeciesMycobacterium tuberculosis
UniProt IDP71543
Gene NamecsoR; Locus:Rv0967, MT0995
Protein NameCopper-sensing transcriptional repressor CsoR
Region Expressed1-119
Expression Tag6xHis
Purity>90%
AA SequenceMSKELTAKKRAALNRLKTVRGHLDGIVRMLESDAYCVDVMKQISAVQSSLERANRVMLHN HLETCFSTAVLDGHGQAAIEELIDAVKFTPALTGPHARLGGAAVGESATEEPMPDASNM
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review