Request QuoteCatalog Number: xP004054HUSize: 0.2-1mg

Request Quote

Recombinant Colipase-like protein 1 (CLPSL1)

Recombinant Colipase-like protein 1 (CLPSL1) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP004054HUYeast1mgQuote
EP004054HUE. coli1mgQuote
BP004054HUBaculovirus200ugQuote
MP004054HUMammalian Cell200ugQuote

Protein Information

SpeciesHomo sapiens (Human)
UniProt IDA2RUU4
Gene NameCLPSL1; aka: C6orf127
Protein NameColipase-like protein 1
Region Expressed24-121
Expression Tag6xHis
Purity>90%
AA SequenceSLSPTKYNLLELKESCIRNQDCETGCCQRAPDNCESHCAEKGSEGSLCQTQVFFGQYRAC PCLRNLTCIYSKNEKWLSIAYGRCQKIGRQKLAKKMFF
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review