Request QuoteCatalog Number: xP340886KBGSize: 0.2-1mg

Request Quote

Recombinant Coenzyme PQQ synthesis protein D (pqqD)

Recombinant Coenzyme PQQ synthesis protein D (pqqD) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP340886KBGYeast1mgQuote
EP340886KBGE. coli1mgQuote
BP340886KBGBaculovirus200ugQuote
MP340886KBGMammalian Cell200ugQuote

Protein Information

SpeciesKlebsiella pneumoniae
UniProt IDP27506
Gene NamepqqD
Protein NameCoenzyme PQQ synthesis protein D
Region Expressed1-92
Expression Tag6xHis
Purity>90%
AA SequenceMQKTSIVAFRRGYRLQWEAAQESHVILYPEGMAKLNETAAAILELVDGRRDVAAIIAMLN ERFPEAGGVDDDVIEFLQIACQQKWITCREPE
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review