Request QuoteCatalog Number: xP004532RASize: 0.2-1mg

Request Quote

Recombinant Cocaine- and amphetamine-regulated transcript protein (Cartpt)

Recombinant Cocaine- and amphetamine-regulated transcript protein (Cartpt) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP004532RAYeast1mgQuote
EP004532RAE. coli1mgRPA352Ra01
BP004532RABaculovirus200ugQuote
MP004532RAMammalian Cell200ugQuote

Protein Information

SpeciesRattus norvegicus (Rat)
UniProt IDP49192
Gene NameCartpt; aka: Cart
Protein NameCocaine- and amphetamine-regulated transcript protein Cleaved into the following 3 chains: 1. CART (1-52) 2. CART (55-102) 3. CART (62-102)
Region Expressed28-129
Expression Tag6xHis
Purity>90%
AA SequenceQEDAELQPRALDIYSAVDDASHEKELPRRQLRAPGAVLQIEALQEVLKKLKSKRIPIYEK KYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review