Request QuoteCatalog Number: xP514397ENUSize: 0.2-1mg

Request Quote

Recombinant Citrate lyase acyl carrier protein (citD)

Recombinant Citrate lyase acyl carrier protein (citD) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP514397ENUYeast1mgQuote
EP514397ENUE. coli1mgQuote
BP514397ENUBaculovirus200ugQuote
MP514397ENUMammalian Cell200ugQuote

Protein Information

SpeciesEscherichia coli (strain K12 / MC4100 / BW2952)
UniProt IDC4ZWA6
Gene NamecitD; Locus:BWG_0490
Protein NameCitrate lyase acyl carrier protein
Region Expressed1-98
Expression Tag6xHis
Purity>90%
AA SequenceMKINQPAVAGTLESGDVMIRIAPLDTQDIDLQINSSVEKQFGDAIRTTILDVLARYNVRG VQLNVDDKGALDCILRARLEALLARASGIPALPWEDCQ
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review