Request QuoteCatalog Number: xP522191BRMSize: 0.2-1mg

Request Quote

Recombinant Cell cycle protein GpsB (gpsB)

Recombinant Cell cycle protein GpsB (gpsB) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP522191BRMYeast1mgQuote
EP522191BRME. coli1mgQuote
BP522191BRMBaculovirus200ugQuote
MP522191BRMMammalian Cell200ugQuote

Protein Information

SpeciesBacillus subtilis subsp. spizizenii (strain ATCC 23059 / NRRL B-14472 / W23)
UniProt IDE0U0L7
Gene NamegpsB; Locus:BSUW23_10870
Protein NameCell cycle protein GpsB
Region Expressed1-98
Expression Tag6xHis
Purity>90%
AA SequenceMLADKVKLSAKEILEKEFKTGVRGYKQEDVDKFLDMIIKDYETFHQEIEELQQENLQLKK QLEEASKKQPVQSNTTNFDILKRLSNLEKHVFGSKLYD
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review