Request QuoteCatalog Number: xP004957BOSize: 0.2-1mg

Request Quote

Recombinant B-cell antigen receptor complex-associated protein alpha chain (CD79A)

Recombinant B-cell antigen receptor complex-associated protein alpha chain (CD79A) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP004957BOYeast1mgQuote
EP004957BOE. coli1mgQuote
BP004957BOBaculovirus200ugQuote
MP004957BOMammalian Cell200ugQuote

Protein Information

SpeciesBos taurus (Bovine)
UniProt IDP40293
Gene NameCD79A; aka: IGA, MB-1
Protein NameB-cell antigen receptor complex-associated protein alpha chain
Region Expressed32-140
Expression Tag6xHis
Purity>90%
AA SequenceLWVEWGPPSVTVSVGEEVRLQCTHNGSNTNVTWWHVLQSNSSWPPVMYRGDVGAGGELII KPVNKTHRGMYRCQVSDGKKIQRSCGTYLRVRDPLPRPFLDMGEGTKNN
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review