Request QuoteCatalog Number: xP005282PYXSize: 0.2-1mg

Request Quote

Recombinant CASP8 and FADD-like apoptosis regulator (CFLAR)

Recombinant CASP8 and FADD-like apoptosis regulator (CFLAR) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP005282PYXYeast1mgQuote
EP005282PYXE. coli1mgQuote
BP005282PYXBaculovirus200ugQuote
MP005282PYXMammalian Cell200ugQuote

Protein Information

SpeciesPongo abelii (Sumatran orangutan)
UniProt IDQ5RD56
Gene NameCFLAR
Protein NameCASP8 and FADD-like apoptosis regulator Cleaved into the following 2 chains: 1. CASP8 and FADD-like apoptosis regulator subunit p43 2. CASP8 and FADD-like apoptosis regulator subunit p12
Region Expressed377-480
Expression Tag6xHis
Purity>90%
AA SequenceGPAMKNVEFKAQKRGLCTVHREADFFWSLCTADVSLLEWSHSSPSLYLQCLSQKLRQERK RPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLIPSYT
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review

Products