Request QuoteCatalog Number: xP304962SSQSize: 0.2-1mg

Request Quote

Recombinant Carbon dioxide concentrating mechanism protein CcmL (ccmL)

Recombinant Carbon dioxide concentrating mechanism protein CcmL (ccmL) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP304962SSQYeast1mgQuote
EP304962SSQE. coli1mgQuote
BP304962SSQBaculovirus200ugQuote
MP304962SSQMammalian Cell200ugQuote

Protein Information

SpeciesSynechocystis sp. (strain PCC 6803 / Kazusa)
UniProt IDP72759
Gene NameccmL; Locus:sll1030
Protein NameCarbon dioxide concentrating mechanism protein CcmL
Region Expressed1-100
Expression Tag6xHis
Purity>90%
AA SequenceMQLAKVLGTVVSTSKTPNLTGVKLLLVQFLDTKGQPLERYEVAGDVVGAGLNEWVLVARG SAARKERGNGDRPLDAMVVGIIDTVNVASGSLYNKRDDGR
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review