Request QuoteCatalog Number: xP005955HUSize: 0.2-1mg

Request Quote

Recombinant cAMP-responsive element-binding protein-like 2 (CREBL2)

Recombinant cAMP-responsive element-binding protein-like 2 (CREBL2) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP005955HUYeast1mgQuote
EP005955HUE. coli1mgQuote
BP005955HUBaculovirus200ugQuote
MP005955HUMammalian Cell200ugQuote

Protein Information

SpeciesHomo sapiens (Human)
UniProt IDO60519
Gene NameCREBL2
Protein NamecAMP-responsive element-binding protein-like 2
Region Expressed1-120
Expression Tag6xHis
Purity>90%
AA SequenceMDDSKVVGGKVKKPGKRGRKPAKIDLKAKLERSRQSARECRARKKLRYQYLEELVSSRER AICALREELEMYKQWCMAMDQGKIPSEIKALLTGEEQNKSQQNSSRHTKAGKTDANSNSW
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review