Request QuoteCatalog Number: xP348040MOSize: 0.2-1mg

Request Quote

Recombinant cAMP-regulated phosphoprotein 19 (Arpp19)

Recombinant cAMP-regulated phosphoprotein 19 (Arpp19) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP348040MOYeast1mgQuote
EP348040MOE. coli1mgQuote
BP348040MOBaculovirus200ugQuote
MP348040MOMammalian Cell200ugQuote

Protein Information

SpeciesMus musculus (Mouse)
UniProt IDP56212
Gene NameArpp19
Protein NamecAMP-regulated phosphoprotein 19
Region Expressed2-112
Expression Tag6xHis
Purity>90%
AA SequenceSAEVPEAASAEEQKEMEDKVTSPEKAEEAKLKARYPHLGQKPGGSDFLRKRLQKGQKYFD SGDYNMAKAKMKNKQLPAAAPDKTEVTGDHIPTPQDLPQRKPSLVASKLAG
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review