Request QuoteCatalog Number: xP002655DOSize: 0.2-1mg

Request Quote

Recombinant Brain-derived neurotrophic factor (BDNF)

Recombinant Brain-derived neurotrophic factor (BDNF) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP002655DOYeast1mgQuote
EP002655DOE. coli1mgRPA011Ca01
BP002655DOBaculovirus200ugQuote
MP002655DOMammalian Cell200ugQuote

Protein Information

SpeciesCanis familiaris (Dog) (Canis lupus familiaris)
UniProt IDQ7YRB4
Gene NameBDNF
Protein NameBrain-derived neurotrophic factor
Region Expressed129-247
Expression Tag6xHis
Purity>90%
AA SequenceHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNP MGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review