Request QuoteCatalog Number: xP009343MOSize: 0.2-1mg

Request Quote

Recombinant Bone morphogenetic protein 3B (Gdf10)

Recombinant Bone morphogenetic protein 3B (Gdf10) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP009343MOYeast1mgQuote
EP009343MOE. coli1mgRPC114Mu01
BP009343MOBaculovirus200ugQuote
MP009343MOMammalian Cell200ugQuote

Protein Information

SpeciesMus musculus (Mouse)
UniProt IDP97737
Gene NameGdf10; aka: Bmp3b
Protein NameBone morphogenetic protein 3B
Region Expressed367-476
Expression Tag6xHis
Purity>90%
AA SequenceQWDEPRVCSRRYLKVDFADIGWNEWIISPKSFDAYYCAGACEFPMPKIVRPSNHATIQSI VRAVGIVPGIPEPCCVPDKMNSLGVLFLDENRNAVLKVYPNMSVETCACR
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review