Request QuoteCatalog Number: xP002740BOSize: 0.2-1mg

Request Quote

Recombinant Bone morphogenetic protein 4 (BMP4)

Recombinant Bone morphogenetic protein 4 (BMP4) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP002740BOYeast1mgQuote
EP002740BOE. coli1mgRPA014Bo01
BP002740BOBaculovirus200ugQuote
MP002740BOMammalian Cell200ugQuote

Protein Information

SpeciesBos taurus (Bovine)
UniProt IDQ2KJH1
Gene NameBMP4
Protein NameBone morphogenetic protein 4
Region Expressed294-409
Expression Tag6xHis
Purity>90%
AA SequenceSPKHHPQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNST NHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review