Request QuoteCatalog Number: xP002736RASize: 0.2-1mg

Request Quote

Recombinant Bone morphogenetic protein 2 (Bmp2)

Recombinant Bone morphogenetic protein 2 (Bmp2) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP002736RAYeast1mgQuote
EP002736RAE. coli1mgRPA013Ra01
BP002736RABaculovirus200ugQuote
MP002736RAMammalian Cell200ugQuote

Protein Information

SpeciesRattus norvegicus (Rat)
UniProt IDP49001
Gene NameBmp2; aka: Bmp-2
Protein NameBone morphogenetic protein 2
Region Expressed280-393
Expression Tag6xHis
Purity>90%
AA SequenceQAKHKQRKRLKSSCKRHPLYVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNH AIVQTLVNSVNSKIPKACCVPTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review