Request QuoteCatalog Number: xP512106SVNSize: 0.2-1mg

Request Quote

Recombinant Biogenesis of lysosome-related organelles complex 1 subunit SNN1 (SNN1)

Recombinant Biogenesis of lysosome-related organelles complex 1 subunit SNN1 (SNN1) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP512106SVNYeast1mgQuote
EP512106SVNE. coli1mgQuote
BP512106SVNBaculovirus200ugQuote
MP512106SVNMammalian Cell200ugQuote

Protein Information

SpeciesSaccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) (Baker's yeast)
UniProt IDC8ZGE4
Gene NameSNN1; ORFs:EC1118_1N9_2806g
Protein NameBiogenesis of lysosome-related organelles complex 1 subunit SNN1
Region Expressed1-102
Expression Tag6xHis
Purity>90%
AA SequenceMAGDSISADGTGVHPVELSVYSVLSTDLDGLYQSINELRESQALLILMLRKVRDKLRREG QVLYDPEPFKPTMDKLADLSARVRILSQRYEELQGNARALNN
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review