Request QuoteCatalog Number: xP514917SVLSize: 0.2-1mg

Request Quote

Recombinant Biogenesis of lysosome-related organelles complex 1 subunit BLI1 (BLI1)

Recombinant Biogenesis of lysosome-related organelles complex 1 subunit BLI1 (BLI1) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP514917SVLYeast1mgQuote
EP514917SVLE. coli1mgQuote
BP514917SVLBaculovirus200ugQuote
MP514917SVLMammalian Cell200ugQuote

Protein Information

SpeciesSaccharomyces cerevisiae (strain JAY291) (Baker's yeast)
UniProt IDC7GP13
Gene NameBLI1; ORFs:C1Q_02019
Protein NameBiogenesis of lysosome-related organelles complex 1 subunit BLI1
Region Expressed1-113
Expression Tag6xHis
Purity>90%
AA SequenceMGEQNKLYYDVEKLVNSLQESFDLDCAQSVSLFTSKSRSNEAWLEELENKFKLKDDVELD DVENLRAEIDMKLNMLEDKVSYYERLYKELEEFQNEIKIKTVVNNRRQSRTPI
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review