Request QuoteCatalog Number: xP303256LMSSize: 0.2-1mg

Request Quote

Recombinant Bifunctional protein pyrR 1 (pyrR1)

Recombinant Bifunctional protein pyrR 1 (pyrR1) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP303256LMSYeast1mgQuote
EP303256LMSE. coli1mgQuote
BP303256LMSBaculovirus200ugQuote
MP303256LMSMammalian Cell200ugQuote

Protein Information

SpeciesLactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
UniProt IDP71479
Gene NamepyrR1; aka: pyrR; Locus:lp_2704
Protein NameBifunctional protein pyrR 1 Including the following 2 domains: Pyrimidine operon regulatory protein 1 Uracil phosphoribosyltransferase 1
Region Expressed1-180
Expression Tag6xHis
Purity>90%
AA SequenceMAREVVDAMTMRRALTRITYEIIEQNKGVGNLVFIGIKTRGIFLAQRLAQRLKQLEGVDV PVGSLDITLYRDDHHAVDVAGQAKLNGADIPVDINGKHVILVDDVLFTGRTVRAALDALM DHGRPAKISLAVLVDRGHRELPIRPDFIGKNIPTALDEQVSVALEEHDGHDGISIEKLEE
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review