Request QuoteCatalog Number: xP002698MOSize: 0.2-1mg

Request Quote

Recombinant BH3-interacting domain death agonist (Bid)

Recombinant BH3-interacting domain death agonist (Bid) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP002698MOYeast1mgQuote
EP002698MOE. coli1mgRPA629Mu01
BP002698MOBaculovirus200ugQuote
MP002698MOMammalian Cell200ugQuote

Protein Information

SpeciesMus musculus (Mouse)
UniProt IDP70444
Gene NameBid
Protein NameBH3-interacting domain death agonist
Region Expressed99-195
Expression Tag6xHis
Purity>90%
AA SequenceHNIQPTLVRQLAAQFMNGSLSEEDKRNCLAKALDEVKTAFPRDMENDKAMLIMTMLLAKK VASHAPSLLRDVFHTTVNFINQNLFSYVRNLVRNEMD
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review