Request QuoteCatalog Number: xP305211ENVSize: 0.2-1mg

Request Quote

Recombinant Bactoprenol-linked glucose translocase homolog from prophage CPS-53 (yfdG)

Recombinant Bactoprenol-linked glucose translocase homolog from prophage CPS-53 (yfdG) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP305211ENVYeast1mgQuote
EP305211ENVE. coli1mgQuote
BP305211ENVBaculovirus200ugQuote
MP305211ENVMammalian Cell200ugQuote

Protein Information

SpeciesEscherichia coli (strain K12)
UniProt IDP77682
Gene NameyfdG; Locus:b2350, JW2346
Protein NameBactoprenol-linked glucose translocase homolog from prophage CPS-53
Region Expressed1-120
Expression Tag6xHis
Purity>90%
AA SequenceMLKLFAKYTSIGVLNTLIHWVVFGVCIYVAHTNQALANFAGFVVAVSFSFFANAKFTFKA STTTMRYMLYVGFMGTLSATVGWAADRCALPPMITLVTFSAISLVCGFVYSKFIVFRDAK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review