Request QuoteCatalog Number: xP527174SXVSize: 0.2-1mg

Request Quote

Recombinant Autophagy-related protein 8 (atg8)

Recombinant Autophagy-related protein 8 (atg8) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP527174SXVYeast1mgQuote
EP527174SXVE. coli1mgQuote
BP527174SXVBaculovirus200ugQuote
MP527174SXVMammalian Cell200ugQuote

Protein Information

SpeciesSchizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
UniProt IDO94272
Gene Nameatg8; ORFs:SPBP8B7.24c
Protein NameAutophagy-related protein 8
Region Expressed1-116
Expression Tag6xHis
Purity>90%
AA SequenceMRSQFKDDFSFEKRKTESQRIREKYPDRIPVICEKVDKSDIAAIDKKKYLVPSDLTVGQF VYVIRKRIKLSPEKAIFIFIDEILPPTAALMSTIYEEHKSEDGFLYITYSGENTFG
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review