Request QuoteCatalog Number: xP333164HUSize: 0.2-1mg

Request Quote

Recombinant Autocrine motility factor receptor, isoform 1 (AMFR)

Recombinant Autocrine motility factor receptor, isoform 1 (AMFR) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP333164HUYeast1mgQuote
EP333164HUE. coli1mgQuote
BP333164HUBaculovirus200ugQuote
MP333164HUMammalian Cell200ugQuote

Protein Information

SpeciesHomo sapiens (Human)
UniProt IDP26442
Gene NameAMFR
Protein NameAutocrine motility factor receptor, isoform 1
Region Expressed18-110
Expression Tag6xHis
Purity>90%
AA SequenceARKRFLNKSSEDDAASESFLPSEGASSDPVTLRRRMLAAARNGGFRSSRPPSAPLPSSAA SCALCPTDWRRPVPILPLHGKAGLTALPLYKAC
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review