Request QuoteCatalog Number: xP002374HUSize: 0.2-1mg

Request Quote

Recombinant ATP synthase subunit g, mitochondrial (ATP5L)

Recombinant ATP synthase subunit g, mitochondrial (ATP5L) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP002374HUYeast1mgQuote
EP002374HUE. coli1mgQuote
BP002374HUBaculovirus200ugQuote
MP002374HUMammalian Cell200ugQuote

Protein Information

SpeciesHomo sapiens (Human)
UniProt IDO75964
Gene NameATP5L
Protein NameATP synthase subunit g, mitochondrial
Region Expressed2-103
Expression Tag6xHis
Purity>90%
AA SequenceAQFVRNLVEKTPALVNAAVTYSKPRLATFWYYAKVELVPPTPAEIPRAIQSLKKIVNSAQ TGSFKQLTVKEAVLNGLVATEVLMWFYVGEIIGKRGIIGYDV
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review