Request QuoteCatalog Number: xP510521SVLSize: 0.2-1mg

Request Quote

Recombinant Arginine biosynthesis bifunctional protein ArgJ, mitochondrial (ARG7)

Recombinant Arginine biosynthesis bifunctional protein ArgJ, mitochondrial (ARG7) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP510521SVLYeast1mgQuote
EP510521SVLE. coli1mgQuote
BP510521SVLBaculovirus200ugQuote
MP510521SVLMammalian Cell200ugQuote

Protein Information

SpeciesSaccharomyces cerevisiae (strain JAY291) (Baker's yeast)
UniProt IDC7GL62
Gene NameARG7; ORFs:C1Q_00992
Protein NameArginine biosynthesis bifunctional protein ArgJ, mitochondrial Cleaved into the following 2 chains: 1. Arginine biosynthesis bifunctional protein ArgJ alpha chain 2. Arginine biosynthesis bifunctional protein ArgJ beta chain 3. Including the following 2 domains: 4. Glutamate N-acetyltransferase
Region Expressed215-441
Expression Tag6xHis
Purity>90%
AA SequenceTLLGFIVTDLPIESKALQKMLTFATTRSFNCISVDGDMSTNDTICMLANGAIDTKEINED SKDFEQVKLQVTEFAQRLAQLVVRDGEGSTKFVTVNVKNALHFEDAKIIAESISNSMLVK TALYGQDANWGRILCAIGYAKLNDLKSLDVNKINVSFIATDNSEPRELKLVANGVPQLEI DETRASEILALNDLEVSVDLGTGDQAAQFWTCDLSHEYVTINGDYRS
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review