Request QuoteCatalog Number: xP300921BQRSize: 0.2-1mg

Request Quote

Recombinant Anti-sigma F factor antagonist (spoIIAA)

Recombinant Anti-sigma F factor antagonist (spoIIAA) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP300921BQRYeast1mgQuote
EP300921BQRE. coli1mgQuote
BP300921BQRBaculovirus200ugQuote
MP300921BQRMammalian Cell200ugQuote

Protein Information

SpeciesBacillus coagulans
UniProt IDP70877
Gene NamespoIIAA
Protein NameAnti-sigma F factor antagonist
Region Expressed1-116
Expression Tag6xHis
Purity>90%
AA SequenceMSLAIDLEVKKDVLCIRLQGELDHHTAESLRASVTKAIEENGIRHLVLNLEQLSFMDSSG LGVILGRYKQIKQKNGEMIVCAISPAVKRLFELSGLFKIIRLDESEQYALHRLGVA
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review