Request QuoteCatalog Number: xP516644SXVSize: 0.2-1mg

Request Quote

Recombinant Anaphase-promoting complex subunit 14 (apc14)

Recombinant Anaphase-promoting complex subunit 14 (apc14) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP516644SXVYeast1mgQuote
EP516644SXVE. coli1mgQuote
BP516644SXVBaculovirus200ugQuote
MP516644SXVMammalian Cell200ugQuote

Protein Information

SpeciesSchizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
UniProt IDO42659
Gene Nameapc14; aka: omt1; ORFs:SPAC27D7.05c
Protein NameAnaphase-promoting complex subunit 14
Region Expressed1-107
Expression Tag6xHis
Purity>90%
AA SequenceMDPFAGTGQSKSYRTFGNVFQRLSMSGNPKPLAKKPLLLPEASKAIEFWNYRDVIGGEEA EQERNERASRIAISRIASSRSSIPEYRQAIMQHLTKHVQQLDQLAEW
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review