Request QuoteCatalog Number: xP514210SVNSize: 0.2-1mg

Request Quote

Recombinant Altered inheritance of mitochondria protein 5, mitochondrial (AIM5)

Recombinant Altered inheritance of mitochondria protein 5, mitochondrial (AIM5) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP514210SVNYeast1mgQuote
EP514210SVNE. coli1mgQuote
BP514210SVNBaculovirus200ugQuote
MP514210SVNMammalian Cell200ugQuote

Protein Information

SpeciesSaccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) (Baker's yeast)
UniProt IDD3UF10
Gene NameAIM5; aka: FMP51; ORFs:EC1118_1B15_4445g
Protein NameAltered inheritance of mitochondria protein 5, mitochondrial
Region Expressed1-106
Expression Tag6xHis
Purity>90%
AA SequenceMSKLGPLARSVKWTLSVGVIGSVFYLYRYSNNGYFYDHDATWLKQDHQVQDLVDRKEVVP GETRNRKLVVTDDGTAWSRTMGESIKDIWNEQIRNSVDWIYSWGKN
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review