Request QuoteCatalog Number: xP511318SVLSize: 0.2-1mg

Request Quote

Recombinant Altered inheritance of mitochondria protein 5, mitochondrial (AIM5)

Recombinant Altered inheritance of mitochondria protein 5, mitochondrial (AIM5) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP511318SVLYeast1mgQuote
EP511318SVLE. coli1mgQuote
BP511318SVLBaculovirus200ugQuote
MP511318SVLMammalian Cell200ugQuote

Protein Information

SpeciesSaccharomyces cerevisiae (strain JAY291) (Baker's yeast)
UniProt IDC7GMW8
Gene NameAIM5; aka: FMP51; ORFs:C1Q_01598
Protein NameAltered inheritance of mitochondria protein 5, mitochondrial
Region Expressed1-106
Expression Tag6xHis
Purity>90%
AA SequenceMSKLGPLARSVKWTLSVGVIGSVFYLYRYSNNGYFYDHDATWLKQDHQVQDLVDRKEVVP GETRNRKLVVTDDGTAWSRTMGESIKDIWNEQIRNSVDWIYSWGKN
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review