Request QuoteCatalog Number: xP330811HOSize: 0.2-1mg

Request Quote

Recombinant Alpha-1-antiproteinase 1

Recombinant Alpha-1-antiproteinase 1 can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP330811HOYeast1mgQuote
EP330811HOE. coli1mgQuote
BP330811HOBaculovirus200ugQuote
MP330811HOMammalian Cell200ugQuote

Protein Information

SpeciesEquus caballus (Horse)
UniProt IDP38028
Gene Name
Protein NameAlpha-1-antiproteinase 1
Region Expressed1-53
Expression Tag6xHis
Purity>90%
AA SequenceEDLQGDAVPETSATKDDNEXPEMIPMSLPPELEINKPFILIIYDDNTKSPLFV
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review