Request QuoteCatalog Number: xP001261MOSize: 0.2-1mg

Request Quote

Recombinant Activin receptor type-2B (Acvr2b)

Recombinant Activin receptor type-2B (Acvr2b) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP001261MOYeast1mgQuote
EP001261MOE. coli1mgRPC118Mu01
BP001261MOBaculovirus200ugQuote
MP001261MOMammalian Cell200ugQuote

Protein Information

SpeciesMus musculus (Mouse)
UniProt IDP27040
Gene NameAcvr2b
Protein NameActivin receptor type-2B
Region Expressed19-137
Expression Tag6xHis
Purity>90%
AA SequenceSGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCW LDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEPGGPEVTYEPPPTAPTLLT
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review