Request QuoteCatalog Number: xP001260XBESize: 0.2-1mg

Request Quote

Recombinant Activin receptor type-2A (acvr2a)

Recombinant Activin receptor type-2A (acvr2a) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP001260XBEYeast1mgQuote
EP001260XBEE. coli1mgQuote
BP001260XBEBaculovirus200ugQuote
MP001260XBEMammalian Cell200ugQuote

Protein Information

SpeciesXenopus laevis (African clawed frog)
UniProt IDP27039
Gene Nameacvr2a; aka: acvr2
Protein NameActivin receptor type-2A
Region Expressed21-136
Expression Tag6xHis
Purity>90%
AA SequenceSILGRSETKECIYYNANWEKDKTNSNGTEICYGDNDKRKHCFATWKNISGSIEIVKQGCW LDDINCYNKSKCTEKKDSPDVFFCCCEGNYCNEKFYHSPEMEVTQPTSNPVTTKPP
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review