Request QuoteCatalog Number: xP001260MOSize: 0.2-1mg

Request Quote

Recombinant Activin receptor type-2A (Acvr2a)

Recombinant Activin receptor type-2A (Acvr2a) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP001260MOYeast1mgQuote
EP001260MOE. coli1mgRPC117Mu01
BP001260MOBaculovirus200ugQuote
MP001260MOMammalian Cell200ugQuote

Protein Information

SpeciesMus musculus (Mouse)
UniProt IDP27038
Gene NameAcvr2a; aka: Acvr2
Protein NameActivin receptor type-2A
Region Expressed20-135
Expression Tag6xHis
Purity>90%
AA SequenceAILGRSETQECLFFNANWERDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCW LDDINCYDRTDCIEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPP
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review