Request QuoteCatalog Number: xP001260HUSize: 0.2-1mg

Request Quote

Recombinant Activin receptor type-2A (ACVR2A)

Recombinant Activin receptor type-2A (ACVR2A) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP001260HUYeast1mgQuote
EP001260HUE. coli1mgRPC117Hu01
BP001260HUBaculovirus200ugQuote
MP001260HUMammalian Cell200ugQuote

Protein Information

SpeciesHomo sapiens (Human)
UniProt IDP27037
Gene NameACVR2A; aka: ACVR2
Protein NameActivin receptor type-2A
Region Expressed20-135
Expression Tag6xHis
Purity>90%
AA SequenceAILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCW LDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPP
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review