Request QuoteCatalog Number: xP529828DLUSize: 0.2-1mg

Request Quote

Recombinant Accessory gland protein Acp62F (Acp62F)

Recombinant Accessory gland protein Acp62F (Acp62F) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP529828DLUYeast1mgQuote
EP529828DLUE. coli1mgQuote
BP529828DLUBaculovirus200ugQuote
MP529828DLUMammalian Cell200ugQuote

Protein Information

SpeciesDrosophila melanogaster (Fruit fly)
UniProt IDO46202
Gene NameAcp62F; ORFs:CG1262
Protein NameAccessory gland protein Acp62F
Region Expressed25-115
Expression Tag6xHis
Purity>90%
AA SequenceMGWQGPKVDCTANGTQTECPVACPETCEYSGNGPCVKMCGAPCVCKPGYVINERIPACVL RSDCPKDVVRKEDMLLGVSNFKCFSRNYNCS
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review