Request QuoteCatalog Number: xP020266BOSize: 0.2-1mg

Request Quote

Recombinant 60S ribosomal protein L37 (RPL37)

Recombinant 60S ribosomal protein L37 (RPL37) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP020266BOYeast1mgQuote
EP020266BOE. coli1mgQuote
BP020266BOBaculovirus200ugQuote
MP020266BOMammalian Cell200ugQuote

Protein Information

SpeciesBos taurus (Bovine)
UniProt IDP79244
Gene NameRPL37
Protein Name60S ribosomal protein L37
Region Expressed2-97
Expression Tag6xHis
Purity>90%
AA SequenceTKGTSSFGKRRNKTHTLCRRCGSKAYHLQKSTCGKCGYPAKRKRKYNWSAKAKRRNTTGT GRMRHLKIVYRRFRHGFREGTTPKPKRAAVAASSSS
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review