Request QuoteCatalog Number: xP020267EWPSize: 0.2-1mg

Request Quote

Recombinant 60S ribosomal protein L37a (RPL37A)

Recombinant 60S ribosomal protein L37a (RPL37A) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP020267EWPYeast1mgQuote
EP020267EWPE. coli1mgQuote
BP020267EWPBaculovirus200ugQuote
MP020267EWPMammalian Cell200ugQuote

Protein Information

SpeciesPlasmodium falciparum (isolate 3D7)
UniProt IDO96184
Gene NameRPL37A; ORFs:PFB0455w
Protein Name60S ribosomal protein L37a
Region Expressed1-96
Expression Tag6xHis
Purity>90%
AA SequenceMSRRTKKVGLTGKYGTRYGSSLRKQIKKIELMQHAKYLCTFCGKTATKRTCVGIWKCKKC KRKVCGGAWSLTTPAAVAAKSTIIRLRKQKEEAQKS
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review