Request QuoteCatalog Number: xP527637EUISize: 0.2-1mg

Request Quote

Recombinant 60S ribosomal protein L44 (RPL44)

Recombinant 60S ribosomal protein L44 (RPL44) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP527637EUIYeast1mgQuote
EP527637EUIE. coli1mgQuote
BP527637EUIBaculovirus200ugQuote
MP527637EUIMammalian Cell200ugQuote

Protein Information

SpeciesPhaffia rhodozyma (Yeast) (Xanthophyllomyces dendrorhous)
UniProt IDO59870
Gene NameRPL44; aka: RPL41
Protein Name60S ribosomal protein L44
Region Expressed2-106
Expression Tag6xHis
Purity>90%
AA SequenceVNVPKTRRTYCKGKACKKHTPHKVTQYKKGKDSIFAQGKRRYDRKQSGYGGQTKPVFHKK AKTTKKVVLRLECSVCKYKMQMTLKRCKHFELGGDKKTKGAAISF
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review